General Information

  • ID:  hor003048
  • Uniprot ID:  Q8MI35
  • Protein name:  Neuropeptide W-30
  • Gene name:  NPW
  • Organism:  Sus scrofa (Pig)
  • Family:  Neuropeptide B/W family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WYKHTASPRYHTVGRAAGLLMGLRRSPYMW
  • Length:  30(33-62)
  • Propeptide:  MGARGPGPGATARRRLLALLLLLLLLPLPARAWYKHTASPRYHTVGRAAGLLMGLRRSPYMWRRALRPAAGPLAWDTFGQDVPPRGPSARNALSPGPAPRDAPLLPPGVQTLWQVRRGSFRSGIPVSAPRSPRARGSEPQPELGASSWTSAE
  • Signal peptide:  MGARGPGPGATARRRLLALLLLLLLLPLPARA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a regulatory role in the organization of neuroendocrine signals accessing the anterior pituitary gland. Stimulates water drinking and food intake. May play a role in the hypothalamic response to stress
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A8MRF9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-A8MRF9-F1.pdbhor003048_AF2.pdbhor003048_ESM.pdb

Physical Information

Mass: 408060 Formula: C163H245N49O38S2
Absent amino acids: CDEFINQ Common amino acids: R
pI: 11.44 Basic residues: 7
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -55.33 Boman Index: -5050
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 58.67
Instability Index: 8499.67 Extinction Coefficient cystines: 15470
Absorbance 280nm: 533.45

Literature

  • PubMed ID:  12130646
  • Title:  Identification of Neuropeptide W as the Endogenous Ligand for Orphan G-protein-coupled Receptors GPR7 and GPR8